PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00007560-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 375aa    MW: 41018 Da    PI: 8.2271
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00007560-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.62.8e-13148192347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  PSME_00007560-RA 148 PWSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 192
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.0435772IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.94141197IPR017930Myb domain
SuperFamilySSF466892.62E-17143198IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-18144196IPR006447Myb domain, plants
SMARTSM007175.1E-11145195IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-11145191IPR009057Homeodomain-like
PfamPF002492.2E-10148192IPR001005SANT/Myb domain
CDDcd001672.19E-9148193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MANIDISVVR GRIELEVLPL GTRTIYVANR YNTQSLSSHG RWMPSSITMA KELLMMCSQC  60
GHSGHSSRAC PDRGSVKLFG VRLTATNDGM ACMRKSLSMG NLGHYRSLYN INHCSGTSEC  120
GSADQDGYLS DGLVHSSSNA RERKKGVPWS EEEHRMFLYG LEKLGKGDWR GISRNFVTTR  180
TPTQVASHAQ KYFLRQSNLN KRKRRSSLFD MCPHDTHVHS SLGREDSLGN LYEFSPNHSA  240
LGVSANLELY SFGFSPTLSL GRSLQPVDPV LEEKAADDGA VNSEEDTSSV SSTTDAPAKE  300
KIPWLSSAPQ SFQLSLWPEL ELMTSSSTSS GNANGMKPNF VHCGENTDLS LSIALPLRTT  360
SLNSKGSLSS AIRVV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1141960.0BT114196.1 Picea glauca clone GQ03510_A24 mRNA sequence.
GenBankEF0870180.0EF087018.1 Picea sitchensis clone WS02911_I03 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P0630.0A9P063_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-64MYB_related family protein